Skip to content

ai4sci-research/BioT5

 
 

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

39 Commits
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

BioT5: Enriching Cross-modal Integration in Biology with Chemical Knowledge and Natural Language Associations 🔥

News

🔥Mar 03 2024: We have published a suvery paper Leveraging Biomolecule and Natural Language through Multi-Modal Learning: A Survey and the related github repository Awesome-Biomolecule-Language-Cross-Modeling. Kindly check it if you are interested in this field~

🔥Feb 29 2024: Update BioT5 to BioT5+ with the ability of IUPAC integration and multi-task learning! Code and data will be relased ASAP.

🔥Nov 06 2023: Update example usage for molecule captioning, text-based molecule generation, drug-target interaction prediction!

🔥Oct 20 2023: The data for fine-tuning is released!

🔥Oct 19 2023: The pre-trained and fine-tuned models are released!

🔥Oct 11 2023: Initial commits. More codes, pre-trained model, and data are coming soon.

Overview

This repository contains the source code for

↓Overview of BioT5

↓Overview of BioT5+

Setup Environment

As the data for fine-tuning is also included in the GitHub, you need to install git-lfs to pull the data correctly. This is an example for how to set up a working conda environment to run the code.

sudo apt-get install git-lfs # run this if you have not installed git-lfs
git lfs install
git clone https://github.com/QizhiPei/BioT5.git --recursive
cd BioT5
conda create -n biot5 python=3.8
conda activate biot5
pip install -r requirements.txt

Example Usage

You can adjust the model and generation configs according to your needs.

Molecule Captioning

from transformers import T5Tokenizer, T5ForConditionalGeneration

tokenizer = T5Tokenizer.from_pretrained("QizhiPei/biot5-base-mol2text", model_max_length=512)
model = T5ForConditionalGeneration.from_pretrained('QizhiPei/biot5-base-mol2text')

task_definition = 'Definition: You are given a molecule SELFIES. Your job is to generate the molecule description in English that fits the molecule SELFIES.\n\n'
selfies_input = '[C][C][Branch1][C][O][C][C][=Branch1][C][=O][C][=Branch1][C][=O][O-1]'
task_input = f'Now complete the following example -\nInput: <bom>{selfies_input}<eom>\nOutput: '

model_input = task_definition + task_input
input_ids = tokenizer(model_input, return_tensors="pt").input_ids

generation_config = model.generation_config
generation_config.max_length = 512
generation_config.num_beams = 1

outputs = model.generate(input_ids, generation_config=generation_config)

print(tokenizer.decode(outputs[0], skip_special_tokens=True))

Text-based Molecule Generation

from transformers import T5Tokenizer, T5ForConditionalGeneration

tokenizer = T5Tokenizer.from_pretrained("QizhiPei/biot5-base-text2mol", model_max_length=512)
model = T5ForConditionalGeneration.from_pretrained('QizhiPei/biot5-base-text2mol')

task_definition = 'Definition: You are given a molecule description in English. Your job is to generate the molecule SELFIES that fits the description.\n\n'
text_input = 'The molecule is a monocarboxylic acid anion obtained by deprotonation of the carboxy and sulfino groups of 3-sulfinopropionic acid. Major microspecies at pH 7.3 It is an organosulfinate oxoanion and a monocarboxylic acid anion. It is a conjugate base of a 3-sulfinopropionic acid.'
task_input = f'Now complete the following example -\nInput: {text_input}\nOutput: '

model_input = task_definition + task_input
input_ids = tokenizer(model_input, return_tensors="pt").input_ids

generation_config = model.generation_config
generation_config.max_length = 512
generation_config.num_beams = 1

outputs = model.generate(input_ids, generation_config=generation_config)
output_selfies = tokenizer.decode(outputs[0], skip_special_tokens=True).replace(' ', '')
print(output_selfies)

import selfies as sf
output_smiles = sf.decoder(output_selfies)
print(output_smiles)

Drug-target Interaction Prediction

from transformers import T5Tokenizer, T5ForConditionalGeneration

def add_prefix_to_amino_acids(protein_sequence):
    amino_acids = list(protein_sequence)
    prefixed_amino_acids = ['<p>' + aa for aa in amino_acids]
    new_sequence = ''.join(prefixed_amino_acids)
    return new_sequence

tokenizer = T5Tokenizer.from_pretrained("QizhiPei/biot5-base-dti-human", model_max_length=512)
model = T5ForConditionalGeneration.from_pretrained('QizhiPei/biot5-base-dti-human')

task_definition = 'Definition: Drug target interaction prediction task (a binary classification task) for the human dataset. If the given molecule and protein can interact with each other, indicate via "Yes". Otherwise, response via "No".\n\n'
selfies_input = '[C][/C][=C][Branch1][C][\\C][C][=Branch1][C][=O][O]'
protein_input = 'MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN'
protein_input = add_prefix_to_amino_acids(protein_input)
task_input = f'Now complete the following example -\nInput: Molecule: <bom>{selfies_input}<eom>\nProtein: <bop>{protein_input}<eop>\nOutput: '

model_input = task_definition + task_input
input_ids = tokenizer(model_input, return_tensors="pt").input_ids

generation_config = model.generation_config
generation_config.max_length = 8
generation_config.num_beams = 1

outputs = model.generate(input_ids, generation_config=generation_config)

print(tokenizer.decode(outputs[0], skip_special_tokens=True))

Data

The datasets for fine-tuning with instruction format can be downloaded from HuggingFace 🤗. We don't wrap the dataset into HuggingFace Dataset format but only use it to store our data. If you don't clone the BioT5 recursively git clone https://github.com/QizhiPei/BioT5.git --recursive, you need to manually clone it by:

git clone https://huggingface.co/datasets/QizhiPei/BioT5_finetune_dataset data

Models

Model Description HuggingFace Checkpoint 🤗
BioT5 Pre-trained BioT5 link
BioT5-Molecule Captioning Fine-tuned BioT5 for molecule captioning task on ChEBI-20 link
BioT5-Text Based Molecule Generation Fine-tuned BioT5 for text based molecule generation task on ChEBI-20 link
BioT5-DTI Fine-tuned BioT5 for drug-target interaction task bindingdb
biosnap
human
BioT5-PPI-Human Fine-tuned BioT5 for protein-protein interaction task with human dataset on PEER benchmark link
BioT5-PPI-Yeast Fine-tuned BioT5 for protein-protein interaction task with yeast dataset on PEER benchmark link
BioT5-Solubility Fine-tuned BioT5 for protein solubility prediction task on PEER benchmark link
BioT5-Binloc Fine-tuned BioT5 for protein binary localization prediction task on PEER benchmark link

We don't include fine-tuned models on MoleculeNet benchmark as there are too many subtasks.

Fine-tuning

export task={mol2text,text2mol,dti,peer}
export model_path="path_to_your_model"
export log_path="logs/test_tmp"
export n_node=1
export n_gpu_per_node=1

bash finetune.sh

The parameter to control downstream tasks corresponds to file names in biot5/configs/task/*.yaml. You can change the n_node and n_gpu_per_node as needed.

Evaluation

export task={mol2text,text2mol,dti,peer}
export result_file_path="tmp.tsv"
export model_path="path_to_your_model"
export log_path="logs/test_tmp"

bash evaluation.sh

We only test the evaluation code with a single gpu.

About

Citations

@article{pei2023biot5,
  title={BioT5: Enriching Cross-modal Integration in Biology with Chemical Knowledge and Natural Language Associations},
  author={Pei, Qizhi and Zhang, Wei and Zhu, Jinhua and Wu, Kehan and Gao, Kaiyuan and Wu, Lijun and Xia, Yingce and Yan, Rui},
  journal={arXiv preprint arXiv:2310.07276},
  year={2023}
}

Acknowledegments

The code is based on nanoT5.

About

BioT5: Enriching Cross-modal Integration in Biology with Chemical Knowledge and Natural Language Associations (EMNLP 2023)

Resources

License

Stars

Watchers

Forks

Releases

No releases published

Packages

 
 
 

Contributors

Languages

  • Python 98.3%
  • Shell 1.7%